PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AS_102EBF3DD.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 96aa    MW: 11190 Da    PI: 8.6974
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AS_102EBF3DD.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB65.11.4e-202454992
                  NF-YB 49 easdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
                            asdkc +ekrktingddl+w+++tlGfedyveplk++lk y++
  Traes_3AS_102EBF3DD.2  2 RASDKCVKEKRKTINGDDLIWSMGTLGFEDYVEPLKLHLKLYQQ 45
                           59***************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471132.27E-13251IPR009072Histone-fold
Gene3DG3DSA:1.10.20.104.1E-16246IPR009072Histone-fold
PRINTSPR006154.3E-8725No hitNo description
PRINTSPR006154.3E-82644No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
RRASDKCVKE KRKTINGDDL IWSMGTLGFE DYVEPLKLHL KLYQQAFEFK RLLLYYNNVH  60
DQQVLLMSSI SYLAIVSAIF TSADMCSGFQ FLHRHG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703064e-61HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW5CIT42e-67W5CIT4_WHEAT; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2563055
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38880.87e-22nuclear factor Y, subunit B1
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]